PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009770905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 305aa    MW: 34725.7 Da    PI: 6.1831
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009770905.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.64.3e-11178222549
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                     kr +r   NR +A+rsR RK++++ eLe+ v +L+ae + L  ++
  XP_009770905.1 178 KRIKRILANRQSAQRSRVRKLQYVSELERSVSTLQAEVSVLSPRV 222
                     999*********************************988776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.9E-14174238IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.634176239IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-13178229No hitNo description
SuperFamilySSF579592.49E-11178232No hitNo description
PfamPF001701.7E-9178222IPR004827Basic-leucine zipper domain
CDDcd147033.43E-21179229No hitNo description
PROSITE patternPS000360181196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MAHLPPRVPN MTPNWPDFSL QKLDNLSPNA TAAHNNPLWA DEFLDFSSKR GSHRRSMSDS  60
IAFLETPMVE ECRRLSSTPG SGGTTTRNEE FERFDDEQQI MSMFNEEHDN MSCSNPSSPS  120
DYINVNEDNK RMNVAGGDRD GQMQQLNEEV QSSCKTNEEP AATHASIEYS CEKVVDPKRI  180
KRILANRQSA QRSRVRKLQY VSELERSVST LQAEVSVLSP RVAFLDHQRL VLNVDNSALR  240
QRIAALSQDK LFKDAHQEAL KREIERLRQI YYQQNLKQME NGTQSKSQPP VADSSAIEMK  300
VQLVN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770905.10.0PREDICTED: basic leucine zipper 61-like
SwissprotQ9M2K41e-102BZP61_ARATH; Basic leucine zipper 61
TrEMBLM1AD361e-147M1AD36_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000202061e-146(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17752465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.11e-103bZIP family protein